PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10017612m
Common NameCARUB_v10017612mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 332aa    MW: 36785.1 Da    PI: 6.9366
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10017612mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++ + g++R+ k+c++rw +yl
  Carubv10017612m 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTHTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.32.3e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Carubv10017612m  67 RGNFTQHEEKMILHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.71965IPR017930Myb domain
SuperFamilySSF466896.88E-3111108IPR009057Homeodomain-like
SMARTSM007172.7E-151363IPR001005SANT/Myb domain
PfamPF002493.4E-171461IPR001005SANT/Myb domain
CDDcd001676.91E-121661No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.06766116IPR017930Myb domain
SMARTSM007171.1E-1566114IPR001005SANT/Myb domain
PfamPF002498.7E-1467112IPR001005SANT/Myb domain
CDDcd001673.77E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGRPPCCDKI GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTHTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TQHEEKMILH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMN  120
DSCDSTINNG VDSKELSSPN KNTTSNQSNS SSKGQWERRL QTDINMAKQA LCDALSLDKP  180
QSQTNFSITD LGYGPSSSSS STTTTTTKST NPYPSGVYAS SAENIARLLQ NFMKDTPKTS  240
VPSPVAATEM AITTAASSPS TTEGEGEGID HSLFSFNSMD EAEEKPKVID HDINGLITQG  300
SLSLFEKWLF DEQSHDMIIN NMSLEGQEVL F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261411627128MYB TRANSFORMING PROTEIN
1mse_C2e-26141164105C-Myb DNA-Binding Domain
1msf_C2e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195950.0AY519595.1 Arabidopsis thaliana MYB transcription factor (At3g47600) mRNA, complete cds.
GenBankBT0028020.0BT002802.1 Arabidopsis thaliana clone RAFL15-01-L01 (R20190) putative transcription factor MYB94 (At3g47600) mRNA, complete cds.
GenBankBT0043610.0BT004361.1 Arabidopsis thaliana clone U20190 putative transcription factor MYB94 (At3g47600) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291477.10.0hypothetical protein CARUB_v10017612mg
SwissprotP813921e-114MYB06_ANTMA; Myb-related protein 306
TrEMBLR0HGR90.0R0HGR9_9BRAS; Uncharacterized protein
STRINGscaffold_501696.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.10.0myb domain protein 94